PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G28500.1
Common NameASL7, LBD11, T17D12.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 232aa    MW: 25534.8 Da    PI: 4.6424
Description LOB domain-containing protein 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G28500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601377e-43551541100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  AT2G28500.1  55 PCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKTQ 152
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                   e
  AT2G28500.1 153 VE 154
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.22854155IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4255152IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MLKMEINGGV ATPTASAVAK VTETTTPVNS PSPTSSPPPP PSPQQPPQPP VVLSPCAACK  60
ILRRRCADKC VLAPYFPPTD PAKFTIAHRV FGASNIIKFL QELPESQRTD AVNSMVYEAG  120
ARMRDPVYGC AGAIYHLQRQ VSELQAQLAK TQVELVGMQL QRSSLLELIY NMEQTKLSVQ  180
EQGQQKMSFE SSFESGDEFI SSPDEESNDL GFLEDNNNNN NSSMSWWDPL WT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.506701e-172floral meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G28500
AtGenExpressAT2G28500
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G28500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G28500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738400.0AB473840.1 Arabidopsis thaliana ASL7 mRNA for ASYMMETRIC LEAVES2-like 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180417.21e-173LOB domain-containing protein 11
SwissprotQ9SK081e-175LBD11_ARATH; LOB domain-containing protein 11
TrEMBLR0FXT91e-136R0FXT9_9BRAS; Uncharacterized protein
STRINGAT2G28500.11e-173(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Maruyama-Nakashita A,Inoue E,Watanabe-Takahashi A,Yamaya T,Takahashi H
    Transcriptome profiling of sulfur-responsive genes in Arabidopsis reveals global effects of sulfur nutrition on multiple metabolic pathways.
    Plant Physiol., 2003. 132(2): p. 597-605
    [PMID:12805590]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Feilner T, et al.
    High throughput identification of potential Arabidopsis mitogen-activated protein kinases substrates.
    Mol. Cell Proteomics, 2005. 4(10): p. 1558-68
    [PMID:16009969]
  6. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]